PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00182.1.g00460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 169aa    MW: 18813.4 Da    PI: 9.7527
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00182.1.g00460.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-181461148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc00182.1.g00460.1.sm.mkhc 14 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 61
                                    79********************************************97 PP

2Myb_DNA-binding58.61.4e-1867111147
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     rg++T eEd++++++++ lG++ W++Ia +++ gRt++++k++w+++
  Zmw_sc00182.1.g00460.1.sm.mkhc  67 RGNFTDEEDDIIIKLHQILGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                                     89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.526961IPR017930Myb domain
SMARTSM007174.4E-131363IPR001005SANT/Myb domain
SuperFamilySSF466891.04E-3013108IPR009057Homeodomain-like
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001672.44E-111661No hitNo description
PROSITE profilePS5129428.01262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2865116IPR009057Homeodomain-like
SMARTSM007172.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.6E-1667111IPR001005SANT/Myb domain
CDDcd001674.70E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIK AHGEGCWRSL PKAAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TDEEDDIIIK LHQILGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG  120
IDPKTHRPLS VTAAGAPPSS GGHSSDEDYS MSVPNLGGID LNLSLSLPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977234.11e-100PREDICTED: myb-related protein Zm38-like
SwissprotQ9SZP15e-88MYB4_ARATH; Transcription repressor MYB4
TrEMBLK3YA561e-100K3YA56_SETIT; Uncharacterized protein
STRINGSi011098m1e-99(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448